PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0118s0310.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 1741aa    MW: 195399 Da    PI: 5.3683
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0118s0310.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.81.6e-172682157
                            TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                            ++kR   +++qle+Le+ +  + yps+  r+eL+ +lgL++rq ++WF+ rR k++k
  SapurV1A.0118s0310.2.p 26 KSKRKMKSASQLEILEKIYSVDTYPSEVVRAELSVQLGLSDRQLQMWFCHRRLKDRK 82
                            67999**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-161482IPR009057Homeodomain-like
SuperFamilySSF466893.29E-152082IPR009057Homeodomain-like
PROSITE profilePS5007116.2442383IPR001356Homeobox domain
SMARTSM003898.9E-152587IPR001356Homeobox domain
CDDcd000864.38E-132682No hitNo description
PfamPF000465.0E-152682IPR001356Homeobox domain
SMARTSM005711.0E-21520579IPR018501DDT domain
PROSITE profilePS5082717.101520579IPR018501DDT domain
PfamPF027912.0E-17521576IPR018501DDT domain
PfamPF050661.5E-15702770IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156127.7E-9916957IPR028942WHIM1 domain
PfamPF156135.3E-1410951167IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1741 aa     Download sequence    Send to blast
MEEAAADGGG VEVEAKNKTP GEGESKSKRK MKSASQLEIL EKIYSVDTYP SEVVRAELSV  60
QLGLSDRQLQ MWFCHRRLKD RKAPSVKRPC KESPSLAGMP SGGETGVVAE VGNEHGSGSS  120
PFVLGVDPRR AVGRPTGVAV PRISADVQTM NRYYEPQQSI AELRAIAFVE AQLGEPLRED  180
GPILGMEFDP LPPDAFGAPI GSATTGQQKQ PVRVFEANLY ERPDVKPIKS TTRTLHEYQF  240
LPQLPTVRAE AYERAAPSCQ YGSPADGHNV KTGSISATLP FMHANEQVSS EYGLSNQVPS  300
LSLMPQESRQ GHRFPSTTER VTHDEDALRM ERKRKSEEAR IAREVEAHEK RIRKELEKQD  360
ILRRRREEQM RKEMEKHDRE RRKEEERLLR EKQREVERYQ REQRRELERR EKYLQKESIR  420
VEKMRQKEEL RREKEAARQK AATERARARR MAKESLELID DERLELMEVA ASSKGLPSII  480
PLDFETLQNL DLFRDKLTEF PPKSVLLKRP FLIQPWNDSE ENVGNLLMVW RFLITFADIL  540
GIWPFTLDEF VQAFHDYDPR LLSEIHVSLL KSIIKDIEDV ARTPSTGLGQ NQNGAANPGG  600
GHPQIVEGAY AWGFDLRSWQ RHLNPLTWPE ILRQFGLSAG FGPQLKKRNV DQAYLRDDNE  660
GNDGEDVITN LRNGAAVENA VSIMQERGFS NPRRSRHRLT PGTVKFAAFH VLSLEGSKGL  720
TILEVADKIQ KSGLRDLTTS KTPEASIAAA LSRDSKLFER TAPSTYCVRQ AYRKDPADAD  780
AILSAAKERI RTFKSGIVDG EDADDAERDE DSESDVAEDP EIDDLGTGLN SKKEAHDSPE  840
NEFNGKTILG NGTESGGALK TPQVRLENVR AGLNSQHSED TNELKGAGSS IDGSVDVAEI  900
CTIPDQDVGI DVSNPGEPWV QGLVEGEYSD LSVEERLNAL VALIGVAIEG NSIRVALEER  960
LEAANALKKQ MWAEAQLDKR RMKEEFVMRT QYSSSTGNKM EPDLTVSATD PMVSVDERSI  1020
GMPVNAFVQQ EQLSDRQIDM NYLNNMPFEG NMQMQDLSSG PDNLPYQQAG HIAEKSRSQL  1080
KSVIGHRAEE MYVYRSLPLG QDRRRNRYWQ FTTSTSHNDP GCGRIFVELH DGRWRLIDSE  1140
EGFDTLLSSL DVRGVRESHL HAMLQKIEVP FKETIRRRML RANTEGQIKD LIKAEAVEMA  1200
AGPESGTGMD SPRSTVCVPD SDMSETSTSF TIELGRNEIE KNHTLKRLQD FEKWMWKECF  1260
KSPVLCAMKY EKKRCTQLLG VCDYCHDTYF FEDSHCPSCH KTLEASQTGL NFSEHVAYCE  1320
RKLKMDPDSA LCSLSFPPRI RLLKLLLALI EVSVLPEALQ PVWTNGHRKS WGMKLQSSSC  1380
VDDLLQILTL LEVGMKRDYL SSNYETSSEL LSSSDPSGCT AHDAFNTETA PVLPWLPHTT  1440
AAVALRIIEF DASISYMLHH KLDSRKDRSA GNFIKLPSKH AVVKNTPDNE TTQTPRQAGL  1500
LPEDDWVDVG VGLAGLGREQ GTGGRGRGRT RGGRSQTKII GSRSESSKKS ASRSSVRLDK  1560
VLSWTVLPRG RGGRKRGRRS IRSRQKAVKK AAEIIPGRKI PKETMYEQST RHLGRHARNV  1620
DETRFHMEEA KNSSSSERSE YNDENENVPV SGDEYDDQVK DDYAGGFNGK SDDLLEGSDY  1680
NIDSNEEEDD DDAMNEDEDE LGNLDVEEYI NRDSDEDGIR DGGQNGDQHG TESSSSDFSD  1740
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2090020.0AC209002.1 Populus trichocarpa clone POP040-E22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011047700.10.0PREDICTED: uncharacterized protein LOC105141971 isoform X3
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLB9HGS00.0B9HGS0_POPTR; Uncharacterized protein
STRINGPOPTR_0007s01330.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator